legle.ss

Über diese Domain
Legless (adjective) 1. To be extremely drunk [British slang] (Collins Dictionary) 2. To have no legs (Collins Dictionary) EXAMPLES "I'm absolutely legless." "They found the locals getting legless on tequila." POSSIBLE USES A premium, bold moniker for the next viral fashion merchandise brand. A tongue-in-cheek personal blog or portfolio for a quirky down-to-earth creative. An eye-catching, viral awareness campaign for the dangers of alcoholism. A shorter, more affordable alternative to legless.com or legless.co.uk.
Related keywords
consultingbusinessserviceslawyerlegaltechcompliancelawfirmlegalservicesmarketingbrandingviral